2. Search Result
Search Result
Results for "

C-terminal peptide

" in MedChemExpress (MCE) Product Catalog:

31

Inhibitors & Agonists

44

Peptides

1

Natural
Products

Cat. No. Product Name Target Research Area
  • HY-P10247
    Amyloid precursor C-terminal peptide

    		Peptides Neurological Disease
    Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .
  • HY-P5923
    E70K

    		CXCR Inflammation/Immunology
    E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
  • HY-P3829
    Beacon (47-73)

    		Peptides Metabolic Disease
    Beacon (47-73) is a C-terminal peptide fragment 47-73 of Beacon, and Beacon is a protein of 73 amino acid. Beacon (47-73) can be used for metabolic syndrome research .
  • HY-P5147
    α-Conotoxin GID

    		nAChR Neurological Disease
    α-Conotoxin GID is a paralytic peptide neurotoxin and a selective antagonist of nAChR, with IC50s of 5 nM (α7), 3 nM (α3β2)， 150 nM (α4β2), respectively. α-Conotoxin GID is small disulfide-rich peptide, with potential to inhibit chronic pain. α-Conotoxin GID contains a C-terminal carboxylate, thus substitution with a C-terminal carboxamide results in loss of α4β2 nAChR. α-Conotoxin GID can be isolated from the Conus species .
  • HY-P4077
    Antennapedia Peptide, amide

    Penetratin amide

    		 Peptides Others
    Antennapedia Peptide, amide is a C-terminal amide cell-penetrating peptide .
  • HY-P4903
    RGD-targeted Proapoptotic Peptide

    		Peptides Cancer
    RGD-targeted Proapoptotic Peptide is a peptide. The C-terminal RGD-4C peptide (ACDCRGDCFC) binds preferentially to integrins at sites of tumor angiogenesis.
  • HY-P3418
    CKLF1-C27

    		CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
  • HY-P3418A
    CKLF1-C27 TFA

    		CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
  • HY-P2531
    OVA (329-337)

    		Peptides Others
    OVA (329-337) is a 9-aa core epitope (329–337) located in the C-terminal end of the OVA peptide .
  • HY-P3315
    Onilcamotide

    RV001

    		 Peptides Inflammation/Immunology Cancer
    Onilcamotide (RV001) is a C-terminal peptide of RhoC protein. Onilcamotide is a cancer vaccine and has potential immunomodulating and antineoplastic activities .
  • HY-P1465
    Secretin (28-54), human

    Human secretin

    		 Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
  • HY-P0312
    c-Myc Peptide TFA
    1 Publications Verification

    		 Peptides Cancer
    c-Myc Peptide (TFA) is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.
  • HY-P1465A
    Secretin (28-54), human TFA

    Human secretin TFA

    		 Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human TFA is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
  • HY-P0199
    Pancreatic Polypeptide, human

    Human pancreatic polypeptide

    		 Neuropeptide Y Receptor Metabolic Disease Endocrinology
    Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
  • HY-P0144
    Thrombospondin-1 (1016-1023) (human, bovine, mouse)

    		Apoptosis Inflammation/Immunology
    Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .
  • HY-P1841
    Glucagon-Like Peptide (GLP) II, human

    		Endogenous Metabolite Apoptosis Metabolic Disease
    Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
  • HY-P1509
    Rhodopsin Epitope Tag

    		Peptides Neurological Disease
    Rhodopsin Epitope Tag is a 9-amino acid peptide localized within the C-terminal region of bovine rhodopsin . Rhodopsin Epitope Tag is widely used as an epitope tag and can be recognized by a number of anti-rhodopsin antibodies.
  • HY-P5124
    β-Amyloid peptide(16-20)

    KLVFF

    		 Amyloid-β Neurological Disease
    β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
  • HY-P5391
    LL-37(17-32)

    		Bacterial Others
    LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
  • HY-P1191
    JIP-1(153-163)

    TI-JIP; JIP-1 peptide; JIPtide

    		 JNK Others
    JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
  • HY-P5323
    Dabcyl-AGHDAHASET-Edans

    		Peptides Others
    Dabcyl-AGHDAHASET-Edans is a biological active peptide. (This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.)
  • HY-P3901
    [Leu8,D-Trp22,Tyr25] Somatostatin-28

    		Peptides Neurological Disease
    [Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .
  • HY-P1191A
    JIP-1(153-163) TFA

    TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA

    		 JNK Others
    JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
  • HY-P5497
    C34 peptide

    		HIV Others
    C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
  • HY-P5370
    Scrambled β-amyloid (1-40)

    		Amyloid-β Others
    Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
  • HY-P1257
    Xenin-8

    		Peptides Metabolic Disease
    Xenin-8, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC50=0.16 nM) .
  • HY-P5182
    HsTX1

    		Potassium Channel Inflammation/Immunology
    HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
  • HY-P5351
    Hyaluronan-binding peptide, biotin labeled

    		Peptides Others
    Hyaluronan-binding peptide, biotin labeled is a biological active peptide. (This peptide is a hyaluronan-binding peptide biotinylated through a C-terminal GGGSK linker. Hyaluronan (HA) is a nonsulfated glycosaminoglycan expressed in the extracellular matrix and on cell surfaces. HA plays a role in fertilization, embryonic development, wound healing, angiogenesis, leukocyte trafficking to inflamed tissues, and cancer metastasis. This peptide has been shown to block HA binding to CD44 receptors and inhibit T cell proliferation.)
  • HY-P1257A
    Xenin-8 TFA

    		Peptides Metabolic Disease
    Xenin-8 TFA, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 TFA stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC50=0.16 nM) .
  • HY-P5527F
    FAM-CSKtide

    		Peptides Others
    FAM-CSKtide is a biological active peptide. (This is a FAM labeled peptide substrate (Abs/Em = 494/521 nm) for C-terminal Src kinase (Csk) and many other kinases such as Axl, cKit, ERBB4, Fes, Flt3, IGF-1 R, MET, MUSK, PYK2, Ret, TIE2, TrkA, VEGF-R1 and VEGF-R2.)
  • HY-107024
    Osteogenic Growth Peptide (10-14)

    OGP(10-14); Historphin

    		 Src Others
    Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor .
  • HY-P5182A
    HsTX1 TFA

    		Potassium Channel Inflammation/Immunology
    HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
  • HY-P5461
    CHRG01

    		Bacterial Others
    CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
  • HY-P5771
    Jingzhaotoxin-IX

    		Sodium Channel Neurological Disease
    Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
  • HY-P1769
    Angiotensin II (5-8), human

    		Angiotensin Receptor Metabolic Disease Endocrinology
    Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
  • HY-P5481
    DABCYL-LPETG-EDANS

    		Peptides Others
    DABCYL-LPETG-EDANS is a biological active peptide. (This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.)
  • HY-P5693
    HBA(111–142)

    		Bacterial CMV HSV Infection
    HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
  • HY-P3982
    CKLF1-C19

    		CCR Inflammation/Immunology
    CKLF1-C19 is the C-terminal peptide of human chemokine-like factor 1 (CKLF1). CKLF1-C19 interacts with CCR4, and inhibits chemotaxis induced by both CKLF1 and CCL17. CKLF1-C19 can suppress allergic lung inflammation via inhibiting chemotaxis mediated by CCR3 and CCR4 .
  • HY-P5519
    [Thr28, Nle31]-Cholecystokinin (25-33), sulfated

    		Peptides Others
    [Thr28, Nle31]-Cholecystokinin (25-33) is a biological active peptide. (Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.)
  • HY-P1210
    Lys-γ3-MSH(human)

    		Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
  • HY-P1210A
    Lys-γ3-MSH(human) TFA

    		Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
  • HY-P2535
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human

    		GLP Receptor Metabolic Disease
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: